DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and AT1G68180

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001319343.1 Gene:AT1G68180 / 843146 AraportID:AT1G68180 Length:235 Species:Arabidopsis thaliana


Alignment Length:72 Identity:23/72 - (31%)
Similarity:42/72 - (58%) Gaps:3/72 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AAQDAIANQAENLSMKRKKIAEENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNKTC 128
            |:|.|| .....:.:..:.:.:|..|.|||..:||..:.:  .:||.||:.::||:.:|..:.||
plant   114 ASQSAI-EAVRTVIITDEDLVKEKVCAICKEEFEVGEEGK--ELKCLHLYHSSCIVSWLNIHNTC 175

  Fly   129 PICKSQM 135
            |||:.::
plant   176 PICRFEV 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 19/51 (37%)
AT1G68180NP_001319343.1 RING_Ubox 138..179 CDD:473075 17/42 (40%)

Return to query results.
Submit another query.