DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and AT1G68070

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_176974.1 Gene:AT1G68070 / 843135 AraportID:AT1G68070 Length:343 Species:Arabidopsis thaliana


Alignment Length:65 Identity:24/65 - (36%)
Similarity:39/65 - (60%) Gaps:2/65 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 AENLSMKRKKIAEENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNKTCPICKSQMIR 137
            :|||..:|..:.|:..|.||..:||...:  .||:.|.|.|.:.||:.:|:.|.|||:||..:::
plant   276 SENLGNERVLLPEDADCCICLSSYEDGAE--LVSLPCNHHFHSTCIVKWLKMNATCPLCKFNILK 338

  Fly   138  137
            plant   339  338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 20/53 (38%)
AT1G68070NP_176974.1 RING-H2_PA-TM-RING 291..333 CDD:438118 17/43 (40%)

Return to query results.
Submit another query.