DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and AT1G49850

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_564556.1 Gene:AT1G49850 / 841408 AraportID:AT1G49850 Length:250 Species:Arabidopsis thaliana


Alignment Length:68 Identity:20/68 - (29%)
Similarity:34/68 - (50%) Gaps:4/68 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 QDAIANQAENLSMKRKKIAEENK-CYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNKTCP 129
            |||| |.....:....::..|.: |.||..:: ..|| ..:|:.|.|.|.::|:..:|:....||
plant   180 QDAI-NCLHRQTFSSAEVKSEMRDCSICLESF-TKGD-MLISLPCTHSFHSSCLNPWLRACGDCP 241

  Fly   130 ICK 132
            .|:
plant   242 CCR 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 15/49 (31%)
AT1G49850NP_564556.1 RING-H2_PA-TM-RING 202..244 CDD:438118 13/43 (30%)

Return to query results.
Submit another query.