DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and AT1G18770

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_173312.1 Gene:AT1G18770 / 838459 AraportID:AT1G18770 Length:106 Species:Arabidopsis thaliana


Alignment Length:47 Identity:16/47 - (34%)
Similarity:27/47 - (57%) Gaps:2/47 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 CYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNKTCPICKSQM 135
            |.||.  .|.:...|.|::.|||.|...|:|.:.:.|.:||:|:.::
plant    59 CIICL--EEFSEGRRVVTLPCGHDFDDECVLKWFETNHSCPLCRFKL 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 16/47 (34%)
AT1G18770NP_173312.1 RING-H2_PA-TM-RING 59..100 CDD:438118 15/42 (36%)

Return to query results.
Submit another query.