DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and AT5G52140

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_200027.2 Gene:AT5G52140 / 835290 AraportID:AT5G52140 Length:280 Species:Arabidopsis thaliana


Alignment Length:82 Identity:23/82 - (28%)
Similarity:36/82 - (43%) Gaps:20/82 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RSSPHSVSEKTPSEMLFNYNI-RDKLPSIFNPIVEHEEVADRDKSKQKSKMY-SDKRGNAKVSSI 72
            |..|.|:    ||.....:.| .|.:||   ||    :|.:.||:.:.|:.: :.:||     .:
plant   387 RLDPDSI----PSPQKTRHRIDPDAIPS---PI----QVIEDDKNNRGSEPFITGQRG-----QV 435

  Fly    73 CP--GDKVLVKRMRKTN 87
            .|  ...||||....|:
plant   436 PPLITTNVLVKDQGNTS 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 1/3 (33%)
AT5G52140NP_200027.2 RING_Ubox 230..278 CDD:473075
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.