powered by:
Protein Alignment CG33552 and AT5G43200
DIOPT Version :9
Sequence 1: | NP_001014488.1 |
Gene: | CG33552 / 3346220 |
FlyBaseID: | FBgn0053552 |
Length: | 157 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_199134.1 |
Gene: | AT5G43200 / 834338 |
AraportID: | AT5G43200 |
Length: | 207 |
Species: | Arabidopsis thaliana |
Alignment Length: | 50 |
Identity: | 17/50 - (34%) |
Similarity: | 26/50 - (52%) |
Gaps: | 3/50 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 85 EENK-CYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQR-NKTCPICK 132
||:| |.||......:.|:..:. .|.|.|...|:..:|.| |.:||:|:
plant 151 EESKTCAICLEELSTSDDYCELP-NCTHCFHEPCLTQWLIRGNNSCPLCR 199
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33552 | NP_001014488.1 |
zf-RING_2 |
87..132 |
CDD:290367 |
14/46 (30%) |
AT5G43200 | NP_199134.1 |
RING |
155..202 |
CDD:238093 |
14/45 (31%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
42 |
1.000 |
Inparanoid score |
I2695 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.960 |
|
Return to query results.
Submit another query.