DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and AT5G37270

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_198543.1 Gene:AT5G37270 / 833701 AraportID:AT5G37270 Length:208 Species:Arabidopsis thaliana


Alignment Length:142 Identity:36/142 - (25%)
Similarity:64/142 - (45%) Gaps:21/142 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 MTKKKLIVEVIKQRKRNKEKDEIIKD-SFESKKRLIDLRLQLDKEK-----------NITKELRL 61
            |||.:|....:......::.||.|.| .|   .||:..|:.||...           .:|:::.|
plant    59 MTKIELKPSCLTSHHIYQDLDEFITDIEF---CRLLSERIALDCAHIPQPFSVSFYVRVTRDVML 120

  Fly    62 ---RLAAQDAIANQAENLSMKRKKIA--EENKCYICKWNYEVTGDHRPVSI-KCGHLFGANCILH 120
               .:.::|......|..:|:...:.  ||..|.||..::..:.|...:.: .|.|||..:||..
plant   121 PSIAVPSRDMFQRLLEEQTMEFTDLGDEEETTCSICLEDFSESHDDNIILLPDCFHLFHQSCIFE 185

  Fly   121 YLQRNKTCPICK 132
            :|:|.::||:|:
plant   186 WLKRQRSCPLCR 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 17/49 (35%)
AT5G37270NP_198543.1 RING-H2_PA-TM-RING 152..197 CDD:438118 14/44 (32%)

Return to query results.
Submit another query.