DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and AT5G15820

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_197086.1 Gene:AT5G15820 / 831439 AraportID:AT5G15820 Length:348 Species:Arabidopsis thaliana


Alignment Length:47 Identity:15/47 - (31%)
Similarity:24/47 - (51%) Gaps:2/47 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 CYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNKTCPICKSQM 135
            |.|||  .||....:...:.|.|.:...||:.:|....|||:|:.::
plant   291 CAICK--DEVVFKEKVKRLPCKHYYHGECIIPWLGIRNTCPVCRHEL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 15/47 (32%)
AT5G15820NP_197086.1 RING_Ubox 291..332 CDD:473075 14/42 (33%)

Return to query results.
Submit another query.