DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and RHB1A

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_567171.1 Gene:RHB1A / 828093 AraportID:AT4G00335 Length:190 Species:Arabidopsis thaliana


Alignment Length:52 Identity:18/52 - (34%)
Similarity:34/52 - (65%) Gaps:2/52 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNKTCPICKSQMI 136
            ||:.|.||..:|:|  ::..::.||.|.|..:|:|.:::|:..||||..:::
plant   135 EEDCCPICFEDYDV--ENPRLTTKCEHEFHLSCLLEWIERSDRCPICDKEVV 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 18/52 (35%)
RHB1ANP_567171.1 RING-H2_AIRP1-like 135..183 CDD:438478 18/49 (37%)

Return to query results.
Submit another query.