DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and RHF1A

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_193158.2 Gene:RHF1A / 827062 AraportID:AT4G14220 Length:371 Species:Arabidopsis thaliana


Alignment Length:46 Identity:15/46 - (32%)
Similarity:23/46 - (50%) Gaps:2/46 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNKTCPIC 131
            ::.|.||...:.:.......|  |.|.:...||:.:.||:|.||||
plant    43 DDACSICLEPFTLQDPSTVTS--CKHEYHLQCIIEWSQRSKECPIC 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 15/46 (33%)
RHF1ANP_193158.2 RING_Ubox 43..95 CDD:473075 15/46 (33%)

Return to query results.
Submit another query.