DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and AT3G03550

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_566208.1 Gene:AT3G03550 / 821237 AraportID:AT3G03550 Length:356 Species:Arabidopsis thaliana


Alignment Length:75 Identity:19/75 - (25%)
Similarity:35/75 - (46%) Gaps:2/75 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 KRKKIAEENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNKTCPICKSQMIRCMDVRI 143
            |.....|.:.|.:|...::.....|.:. ||.|.|...||..:|:.:..||:|::.::....|.|
plant   149 KMDGFVESSDCSVCLSEFQENESLRLLP-KCNHAFHVPCIDTWLKSHSNCPLCRAFIVTSSAVEI 212

  Fly   144 I-IAGQNLCT 152
            : :..|.:.|
plant   213 VDLTNQQIVT 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 15/58 (26%)
AT3G03550NP_566208.1 HRD1 <136..>229 CDD:227568 19/75 (25%)
RING-H2_EL5-like 158..201 CDD:438124 12/43 (28%)

Return to query results.
Submit another query.