DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and AT3G02340

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_186883.1 Gene:AT3G02340 / 821090 AraportID:AT3G02340 Length:409 Species:Arabidopsis thaliana


Alignment Length:49 Identity:14/49 - (28%)
Similarity:26/49 - (53%) Gaps:2/49 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 NKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNKTCPICKSQM 135
            |.|.:||  .|:..:.:...:.|.|.:...||:.:|....|||:|:.::
plant   333 NVCAVCK--DEMLVEEKVRRLPCSHFYHGECIIPWLGIRNTCPVCRYEL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 14/49 (29%)
AT3G02340NP_186883.1 RING_Ubox 335..376 CDD:473075 12/42 (29%)

Return to query results.
Submit another query.