DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and AT3G15070

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_566498.1 Gene:AT3G15070 / 820736 AraportID:AT3G15070 Length:486 Species:Arabidopsis thaliana


Alignment Length:109 Identity:30/109 - (27%)
Similarity:47/109 - (43%) Gaps:24/109 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LQLDKEKNITKELRLRLAAQDAIANQAENLS-------MKRKKIA------------EENKCYIC 92
            ::||.|....:||   ||..|.|......||       :||:...            |.:.|.||
plant   370 MRLDIEDMSYEEL---LALSDQIGTVKTGLSSEDVKELLKRRTSTRINLEEGPSTDLETDSCTIC 431

  Fly    93 KWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNKTCPICKSQMI 136
            :.||:  .:.:..::.|.|.:.|.|:..:|.....||||||:.:
plant   432 QENYK--NEDKIATLDCMHKYHAECLKKWLVIKNVCPICKSEAL 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 17/52 (33%)
AT3G15070NP_566498.1 RING-H2_RNF24-like 426..472 CDD:438132 16/47 (34%)

Return to query results.
Submit another query.