DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and XERICO

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_178507.1 Gene:XERICO / 814962 AraportID:AT2G04240 Length:162 Species:Arabidopsis thaliana


Alignment Length:104 Identity:28/104 - (26%)
Similarity:49/104 - (47%) Gaps:19/104 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DSFESKKRLIDLRLQLDKEKNITKELRLRLAAQDAIANQAENLSMKRKKIAEENKCYICKWNYEV 98
            :||:.  |:......|::.:|.|..||..              |:.|.|...:|:|.:|...:: 
plant    64 ESFDF--RVCQPESYLEEFRNRTPTLRFE--------------SLCRCKKQADNECSVCLSKFQ- 111

  Fly    99 TGDHRPVSIKCGHLFGANCILHYLQR-NKTCPICKSQMI 136
             ||.....:||||||...|:..::.. |.|||:|::.::
plant   112 -GDSEINKLKCGHLFHKTCLEKWIDYWNITCPLCRTPLV 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 17/53 (32%)
XERICONP_178507.1 RING-H2_RHA1-like 100..148 CDD:438483 17/49 (35%)

Return to query results.
Submit another query.