DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and RNF128

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_919445.1 Gene:RNF128 / 79589 HGNCID:21153 Length:428 Species:Homo sapiens


Alignment Length:110 Identity:29/110 - (26%)
Similarity:54/110 - (49%) Gaps:10/110 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 FESKKRLIDLRLQLDKEKNITKELRLRLAAQDAIAN-QAENLSMKRKKIAEE-NKCYICKWNYEV 98
            |.|.:||.:.|.|..|::      :|:..|:.||.. |...|....|:|..: :.|.:|...|:.
Human   228 FYSARRLRNARAQSRKQR------QLKADAKKAIGRLQLRTLKQGDKEIGPDGDSCAVCIELYKP 286

  Fly    99 TGDHRPVSIKCGHLFGANCILHYLQRNKTCPICKSQMIRCMDVRI 143
            ....|  .:.|.|:|...|:..:|..::|||:||..:::.:.:.:
Human   287 NDLVR--ILTCNHIFHKTCVDPWLLEHRTCPMCKCDILKALGIEV 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 14/60 (23%)
RNF128NP_919445.1 PA_GRAIL_like 48..193 CDD:239037
RING-H2_RNF128-like 275..323 CDD:438454 14/49 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 346..428
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.