DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and PJA1

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_660095.1 Gene:PJA1 / 64219 HGNCID:16648 Length:643 Species:Homo sapiens


Alignment Length:150 Identity:32/150 - (21%)
Similarity:52/150 - (34%) Gaps:42/150 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 NKEKDEIIKDSFESKKRLID------------------LRLQLDKEKNITKELRLRLAAQDAIAN 71
            |.|.|..:.:..|....|.|                  ....:..|:.:.:.:...||..:::|.
Human   496 NLEDDSSVSEDLEVDWSLFDGFADGLGVAEAISYVDPQFLTYMALEERLAQAMETALAHLESLAV 560

  Fly    72 QAENLSMKRKK-----------------IAEENKCYICKWNYEVTGDHRPVSIKCGHLFGANCIL 119
            ..|..:....|                 :.:|..|.||...| |.|: ....:.|.|.|...|:.
Human   561 DVEVANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEY-VKGE-VATELPCHHYFHKPCVS 623

  Fly   120 HYLQRNKTCPICKSQMIRCM 139
            .:||::.|||:|     |||
Human   624 IWLQKSGTCPVC-----RCM 638

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 19/54 (35%)
PJA1NP_660095.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..363
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..454
RING-H2_PJA1_2 594..639 CDD:438128 18/51 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.