DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG33552 and RNF4

DIOPT Version :9

Sequence 1:	NP_001014488.1	Gene:	CG33552 / 3346220	FlyBaseID:	FBgn0053552	Length:	157	Species:	Drosophila melanogaster
Sequence 2:	NP_001171938.1	Gene:	RNF4 / 6047	HGNCID:	10067	Length:	190	Species:	Homo sapiens

Alignment Length:	138	Identity:	34/138 - (24%)
Similarity:	59/138 - (42%)	Gaps:	32/138 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly    29 DEIIKDSFESKKRLI------DLRLQLDKEKNITKELRLRLAAQDA----IANQAENLSMKR--- 80
            |||:..:.||.:.::      |..:.:|:.:...:..| ||....|    :::..|.||..|
Human    44 DEIVDLTCESLEPVVVDLTHNDSVVIVDERRRPRRNAR-RLPQDHADSCVVSSDDEELSRDRDVY 107

  Fly    81 ------KKIAEEN----------KCYICKWNY-EVTGDHR-PVSIKCGHLFGANCILHYLQRNKT 127
                  :...:|.          .|.||...| |:..:.| .||.:|||:|.:.|:...|:...|
Human   108 VTTHTPRNARDEGATGLRPSGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKNANT 172

  Fly   128 CPICKSQM 135
            ||.|:.::
Human   173 CPTCRKKI 180

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG33552	NP_001014488.1	zf-RING_2	87..132	CDD:290367	17/56 (30%)
RNF4	NP_001171938.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..29
		Required for ubiquitination activity. /evidence=ECO:0000250	1..16
		Mediates interaction with TRPS1. /evidence=ECO:0000250	4..61		5/16 (31%)
		SUMO interaction motif 1. /evidence=ECO:0000269\|PubMed:18408734	36..39
		SUMO interaction motif 2. /evidence=ECO:0000269\|PubMed:18408734	46..49		1/2 (50%)
		SUMO interaction motif 3. /evidence=ECO:0000269\|PubMed:18408734	57..59		0/1 (0%)
		SUMO interaction motif 4. /evidence=ECO:0000269\|PubMed:18408734	67..70		0/2 (0%)
		RING-HC_RNF4	127..180	CDD:319447	18/52 (35%)
		RING-HC finger (C3HC4-type)	132..176	CDD:319447	17/43 (40%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0001208
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.910