DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and rnf4

DIOPT Version :9

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001373177.1 Gene:rnf4 / 557319 ZFINID:ZDB-GENE-041008-246 Length:184 Species:Danio rerio


Alignment Length:136 Identity:31/136 - (22%)
Similarity:56/136 - (41%) Gaps:12/136 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DKQDITKMTKKKLIVEVIKQRKRNKEKDEIIKDSFESKKRLIDLRLQLDKEKNITKELRLRLAAQ 66
            |..|:|....:..:|::     .|.:...:::|..:.:.........|..::.....|||.....
Zfish    49 DVVDLTCEGSEPAVVDL-----TNNDSIVVVEDGVQRRVGPCTESYVLSSDEEEESSLRLSPGLL 108

  Fly    67 DAIANQAENLSMKRKKIAEENKCYICKWNY-EVTGDHR-PVSIKCGHLFGANCILHYLQRNKTCP 129
            .::.:     |.:.:.......|.:|...| |:....| .||.||||||.:.||...|.|..:||
Zfish   109 SSLRD-----SSRARSTPGAISCPVCMDVYSEIMDSGRLMVSTKCGHLFCSQCIRDSLSRAHSCP 168

  Fly   130 ICKSQM 135
            .|:.::
Zfish   169 TCRKKL 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 19/46 (41%)
rnf4NP_001373177.1 RING-HC_RNF4 121..174 CDD:319447 20/52 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.