DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and RNF126

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_919442.1 Gene:RNF126 / 55658 HGNCID:21151 Length:311 Species:Homo sapiens


Alignment Length:106 Identity:28/106 - (26%)
Similarity:46/106 - (43%) Gaps:32/106 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DAI----ANQAENL-----------SMKRKKIAEEN-----KCYICKWNYEVTGDHRPVSIKCGH 111
            |||    .||.||.           ::....:.||:     :|.:||.:|.:  ..|...:.|.|
Human   187 DAIITQLLNQFENTGPPPADKEKIQALPTVPVTEEHVGSGLECPVCKDDYAL--GERVRQLPCNH 249

  Fly   112 LFGANCILHYLQRNKTCPICKSQMIRCMDVRIIIAGQNLCT 152
            ||...||:.:|:::.:||:|:..          :.|||..|
Human   250 LFHDGCIVPWLEQHDSCPVCRKS----------LTGQNTAT 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 17/63 (27%)
RNF126NP_919442.1 Required for interaction with BAG6. /evidence=ECO:0000269|PubMed:24981174 5..100
zinc_ribbon_9 10..40 CDD:433910
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..64
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 94..132
Sufficient for interaction with AICDA. /evidence=ECO:0000269|PubMed:23277564 200..304 21/93 (23%)
RING_Ubox 227..276 CDD:473075 15/60 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 277..311 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.