DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and RFWD3

DIOPT Version :9

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001357463.1 Gene:RFWD3 / 55159 HGNCID:25539 Length:774 Species:Homo sapiens


Alignment Length:63 Identity:23/63 - (36%)
Similarity:37/63 - (58%) Gaps:2/63 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQ-RNKTCPICKSQMIRCMDVRIIIA 146
            |.:.|.||...:...||||..:::||||||..||..:|: :.:.||.| ::..|..|:.::.|
Human   283 EGDTCTICLEQWTNAGDHRLSALRCGHLFGYRCISTWLKGQVRKCPQC-NKKARHSDIVVLYA 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 18/45 (40%)
RFWD3NP_001357463.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..116
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..225
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..280
mRING-C3HGC3_RFWD3 283..331 CDD:319364 20/48 (42%)
WD40 <486..774 CDD:225201
WD 1 495..537
WD40 repeat 500..537 CDD:293791
WD 2 539..577
WD40 repeat 543..580 CDD:293791
WD 3 583..628
WD40 repeat 588..655 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146168
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.