powered by:
Protein Alignment CG33552 and RFWD3
DIOPT Version :9
Sequence 1: | NP_001014488.1 |
Gene: | CG33552 / 3346220 |
FlyBaseID: | FBgn0053552 |
Length: | 157 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001357463.1 |
Gene: | RFWD3 / 55159 |
HGNCID: | 25539 |
Length: | 774 |
Species: | Homo sapiens |
Alignment Length: | 63 |
Identity: | 23/63 - (36%) |
Similarity: | 37/63 - (58%) |
Gaps: | 2/63 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 85 EENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQ-RNKTCPICKSQMIRCMDVRIIIA 146
|.:.|.||...:...||||..:::||||||..||..:|: :.:.||.| ::..|..|:.::.|
Human 283 EGDTCTICLEQWTNAGDHRLSALRCGHLFGYRCISTWLKGQVRKCPQC-NKKARHSDIVVLYA 344
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C165146168 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1451258at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.850 |
|
Return to query results.
Submit another query.