DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and rlim

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001016091.1 Gene:rlim / 548845 XenbaseID:XB-GENE-492020 Length:639 Species:Xenopus tropicalis


Alignment Length:98 Identity:26/98 - (26%)
Similarity:44/98 - (44%) Gaps:22/98 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DKEKNITKELRLRLAAQDAIANQAENLSMKRKKIAEENKCYICKWNYEVTGDHRPVSIKCGHLFG 114
            |:.:.:|||....|:.:    |..||.::|        .|.:|...|  |..::...:.|.|.:.
 Frog   558 DQPRGLTKEQIDNLSTR----NFGENDALK--------TCSVCITEY--TEGNKLRKLPCSHEYH 608

  Fly   115 ANCILHYLQRNKTCPICKSQMIRCMDVRIIIAG 147
            .:||..:|..|.|||||:.        .:::||
 Frog   609 VHCIDRWLSENSTCPICRR--------AVLVAG 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 15/58 (26%)
rlimNP_001016091.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..403
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 467..534
RING-H2_RNF12 583..633 CDD:438336 16/67 (24%)
PDZ-binding. /evidence=ECO:0000255 636..639
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.