DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and RLIM

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_057204.2 Gene:RLIM / 51132 HGNCID:13429 Length:624 Species:Homo sapiens


Alignment Length:103 Identity:27/103 - (26%)
Similarity:44/103 - (42%) Gaps:29/103 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DKEKNITKELRLRLAAQDAIANQAENLSMKRKKIAEEN---KCYICKWNYEVTGDHRPVSIKCGH 111
            |:.:.:|||             |.:||:|  :...|.:   .|.:|...|  |..::...:.|.|
Human   543 DQPRGLTKE-------------QIDNLAM--RSFGENDALKTCSVCITEY--TEGNKLRKLPCSH 590

  Fly   112 LFGANCILHYLQRNKTCPICKSQMIRCMDVRIIIAGQN 149
            .:..:||..:|..|.|||||:         |.::|..|
Human   591 EYHVHCIDRWLSENSTCPICR---------RAVLASGN 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 17/61 (28%)
RLIMNP_057204.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 72..251
PHA03307 159..>348 CDD:223039
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 257..276
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 291..363
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..522
RING-H2_RNF12 568..618 CDD:438336 17/60 (28%)
PDZ-binding. /evidence=ECO:0000255 621..624
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.