DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and mura

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_731367.2 Gene:mura / 41145 FlyBaseID:FBgn0037705 Length:1173 Species:Drosophila melanogaster


Alignment Length:86 Identity:22/86 - (25%)
Similarity:40/86 - (46%) Gaps:22/86 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DAIANQAENL------SMKRKKI--------------AEENKCYICKWNYEVTGDHRPVSIKCGH 111
            :|:.:.||.|      .:.|.:|              .:::.|.:|..::|:....|  .:.|.|
  Fly  1035 EALLSLAERLGEAKPRGLTRNEIDQLPSYKFNPEVHNGDQSSCVVCMCDFELRQLLR--VLPCSH 1097

  Fly   112 LFGANCILHYLQRNKTCPICK 132
            .|.|.|:..:|:.|:|||||:
  Fly  1098 EFHAKCVDKWLRSNRTCPICR 1118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 16/48 (33%)
muraNP_731367.2 RING-H2_RNF38-like 1073..1118 CDD:438135 15/46 (33%)

Return to query results.
Submit another query.