DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and CG13025

DIOPT Version :9

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001261971.1 Gene:CG13025 / 39874 FlyBaseID:FBgn0036660 Length:608 Species:Drosophila melanogaster


Alignment Length:136 Identity:39/136 - (28%)
Similarity:62/136 - (45%) Gaps:32/136 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RKRNKEKDEIIKDSFESKKRLIDLRLQLDKEKNITKELRLRLAAQDAIANQAENLSMKRKKIAEE 86
            |:...|:.|:|               .|:......|..||..||..::....|.     |.|..:
  Fly    79 RRNQGEEQEVI---------------SLETPSPPKKRKRLSAAADKSLKKSPEG-----KPIVVD 123

  Fly    87 NK-----CYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRN------KTCPICKSQMIRCMD 140
            ::     |.||..::|::|:||.||::||||||.:||..:|..:      |.||.||:: ....|
  Fly   124 DEDDGMTCPICLDSWEMSGEHRLVSLRCGHLFGESCIRRWLNESHRQSSVKVCPQCKTK-ATFRD 187

  Fly   141 VRIIIA 146
            :|.:.|
  Fly   188 IRHLYA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 21/55 (38%)
CG13025NP_001261971.1 zf-RING_2 130..180 CDD:290367 21/49 (43%)
WD40 <293..445 CDD:295369
WD40 <318..>415 CDD:225201
WD40 repeat 339..375 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447441
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.