DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and CG13481

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001097605.1 Gene:CG13481 / 39579 FlyBaseID:FBgn0036421 Length:176 Species:Drosophila melanogaster


Alignment Length:176 Identity:43/176 - (24%)
Similarity:80/176 - (45%) Gaps:44/176 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QDITKMTKKKLIVEVIKQRKRNKEKDEIIKDSFESKKRLIDLRLQLD------------------ 50
            :.:.||  |.|:.::|..        ::.:..|...::|:|..:.::                  
  Fly     7 ESLNKM--KSLVGKMIFM--------QVTEHLFLRAQQLLDSDVSIEERVRRMEVLNNNMKWFNS 61

  Fly    51 KEKNITKELRLRLAAQDAI-----ANQAEN----------LSMKRKKIAEENKCYICKWNYEVTG 100
            :...|.::|:|.:..|.::     .|.:||          ||.:.:.:.|:..|.||...:...|
  Fly    62 ERTRILEQLQLNIFGQISVEHHNAMNMSENLYELREGLDGLSRRMESMQEDITCSICLSPWSSNG 126

  Fly   101 DHRPVSIKCGHLFGANCILHYLQRNKTCPICKSQMIRCMDVRIIIA 146
            .||.||::||||||.:||...::|:..||||:.:.:.. |||.|.:
  Fly   127 RHRVVSLRCGHLFGNSCIRTAIRRSHRCPICRRRALHA-DVRRIFS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 25/58 (43%)
CG13481NP_001097605.1 mRING-C3HGC3_RFWD3 111..170 CDD:438114 25/59 (42%)

Return to query results.
Submit another query.