DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and CG13481

DIOPT Version :9

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001097605.1 Gene:CG13481 / 39579 FlyBaseID:FBgn0036421 Length:176 Species:Drosophila melanogaster


Alignment Length:176 Identity:43/176 - (24%)
Similarity:80/176 - (45%) Gaps:44/176 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QDITKMTKKKLIVEVIKQRKRNKEKDEIIKDSFESKKRLIDLRLQLD------------------ 50
            :.:.||  |.|:.::|..        ::.:..|...::|:|..:.::                  
  Fly     7 ESLNKM--KSLVGKMIFM--------QVTEHLFLRAQQLLDSDVSIEERVRRMEVLNNNMKWFNS 61

  Fly    51 KEKNITKELRLRLAAQDAI-----ANQAEN----------LSMKRKKIAEENKCYICKWNYEVTG 100
            :...|.::|:|.:..|.::     .|.:||          ||.:.:.:.|:..|.||...:...|
  Fly    62 ERTRILEQLQLNIFGQISVEHHNAMNMSENLYELREGLDGLSRRMESMQEDITCSICLSPWSSNG 126

  Fly   101 DHRPVSIKCGHLFGANCILHYLQRNKTCPICKSQMIRCMDVRIIIA 146
            .||.||::||||||.:||...::|:..||||:.:.:.. |||.|.:
  Fly   127 RHRVVSLRCGHLFGNSCIRTAIRRSHRCPICRRRALHA-DVRRIFS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 20/44 (45%)
CG13481NP_001097605.1 zf-RING_2 114..158 CDD:290367 20/43 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447450
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2695
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.