DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and CG14983

DIOPT Version :9

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_647843.1 Gene:CG14983 / 38466 FlyBaseID:FBgn0035479 Length:163 Species:Drosophila melanogaster


Alignment Length:150 Identity:47/150 - (31%)
Similarity:74/150 - (49%) Gaps:21/150 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IVEVIKQ-RKRNKEKDEII-KDSFES-KKRLIDL-----RLQL--DKEKNITKELRLRLAAQDAI 69
            ||:::|: :::.||..||| ::||.| ::||..|     |:.|  .:..||...|:..|...:..
  Fly     7 IVDLLKELQEQEKEIQEIILEESFASPEQRLAQLESVTSRMHLYHSRRGNILMSLQQELGKYEYF 71

  Fly    70 ANQAENLSMKRKKIAEENK----------CYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQR 124
            .....:::.....:...||          |.||....|..|.|..||::||||||.:||.:.|:.
  Fly    72 TLLVRHIAQTHSYLKSLNKALDFLYKVNICSICDLKCEPHGRHSMVSLRCGHLFGRHCINNVLRE 136

  Fly   125 NKTCPICKSQMIRCMDVRII 144
            :..||.| |:..|..:||.|
  Fly   137 SSRCPTC-SRRARHHEVRRI 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 21/54 (39%)
CG14983NP_647843.1 zf-RING_2 99..143 CDD:290367 19/43 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447448
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2695
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.