DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and nopo

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_611305.1 Gene:nopo / 37083 FlyBaseID:FBgn0034314 Length:435 Species:Drosophila melanogaster


Alignment Length:68 Identity:23/68 - (33%)
Similarity:34/68 - (50%) Gaps:7/68 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 CYICKWNYEVTGDHRPV-SIKCGHLFGANCILHYLQRNKTCPICKSQMIRCMDVRIIIAGQNLCT 152
            |.||.   |:.|....| :..|||:|..||:..:|.|:||||.|::   :|....|.....||..
  Fly     6 CVICA---ELFGQADEVFATVCGHMFHHNCLNQWLDRSKTCPQCRN---KCTTRNIFRVYFNLAN 64

  Fly   153 AEL 155
            .::
  Fly    65 LDV 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 20/55 (36%)
nopoNP_611305.1 RING-H2_TRAIP 5..47 CDD:438143 18/43 (42%)
SMC_N <75..>255 CDD:481474
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.