DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and elfless

DIOPT Version :9

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_001163003.1 Gene:elfless / 35076 FlyBaseID:FBgn0032660 Length:229 Species:Drosophila melanogaster


Alignment Length:69 Identity:20/69 - (28%)
Similarity:31/69 - (44%) Gaps:10/69 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 ANQAENLSMKRKKIAEENK-------CYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNKT 127
            :|:....:.:.|...||:|       |.:|   .|...:..|||..|||:|...||...:...:.
  Fly   152 SNEDSPPNKRIKSDDEESKKSVLPYNCPVC---LEDVREKLPVSTNCGHVFCKACIKRAVDTGRV 213

  Fly   128 CPIC 131
            ||:|
  Fly   214 CPLC 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 16/52 (31%)
elflessNP_001163003.1 RING 178..217 CDD:214546 14/41 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.