DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and CG17329

DIOPT Version :9

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_609784.2 Gene:CG17329 / 34958 FlyBaseID:FBgn0028896 Length:162 Species:Drosophila melanogaster


Alignment Length:134 Identity:43/134 - (32%)
Similarity:70/134 - (52%) Gaps:9/134 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KQDITKMTKKKLIVEVIKQRKRNKEKDEIIKDSFESKKRLIDLRLQLDKEKNITKELRL-RLAAQ 66
            :|:.|:.:...|..:|.|.|..|..    :|.....::|::.| ||....:..|.|.|| |:...
  Fly    15 QQEPTEPSNGNLEEQVRKLRDHNLR----VKHLNTQRRRILRL-LQGKMLQYATLEERLHRIGEL 74

  Fly    67 DAIA---NQAENLSMKRKKIAEENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNKTC 128
            ..||   :..:.|:.:..::.|.:.|.||...:...|.||.||::||||||::||...::||..|
  Fly    75 VLIAELHSGVKTLNQRLDRMVENSTCSICLLPWTDNGIHRLVSLRCGHLFGSSCIHMAIRRNHRC 139

  Fly   129 PICK 132
            |||:
  Fly   140 PICR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 21/44 (48%)
CG17329NP_609784.2 zf-RING_2 99..143 CDD:290367 21/43 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447449
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 42 1.000 Inparanoid score I2695
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1451258at2759
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.