DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and Rnf4

DIOPT Version :9

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_062055.1 Gene:Rnf4 / 29274 RGDID:3583 Length:194 Species:Rattus norvegicus


Alignment Length:141 Identity:29/141 - (20%)
Similarity:62/141 - (43%) Gaps:18/141 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DITKMTKKKLIVE--------VIKQRKRNKEKDEIIKDSFESKKRLIDLRLQLDKEKNITKELRL 61
            |:|..:.:.::|:        ::::|:|.:.....::........:.....:|.|:|::......
  Rat    52 DLTCESLEPVVVDLTHNDSVVIVEERRRPRRNGRRLRQDHADSCVVSSDDEELSKDKDVYVTTHT 116

  Fly    62 RLAAQDAIANQAENLSMKRKKIAEENKCYICKWNY-EVTGDHR-PVSIKCGHLFGANCILHYLQR 124
            ..:.:|      |..:..|.  :....|.||...| |:..:.| .||.:|||:|.:.|:...|:.
  Rat   117 PRSTKD------EGTTGLRP--SGTVSCPICMDGYSEIVQNGRLIVSTECGHVFCSQCLRDSLKN 173

  Fly   125 NKTCPICKSQM 135
            ..|||.|:.::
  Rat   174 ANTCPTCRKKI 184

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 17/46 (37%)
Rnf4NP_062055.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36
Required for ubiquitination activity. /evidence=ECO:0000250 1..20
Mediates interaction with TRPS1. /evidence=ECO:0000250 6..65 3/12 (25%)
SUMO interaction motif 1. /evidence=ECO:0000269|PubMed:18408734 40..43