DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and rfp2

DIOPT Version :9

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_593439.1 Gene:rfp2 / 2543192 PomBaseID:SPAC343.18 Length:205 Species:Schizosaccharomyces pombe


Alignment Length:127 Identity:24/127 - (18%)
Similarity:50/127 - (39%) Gaps:32/127 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QRKRNKEKDE---IIKDSFESKKRLIDLRLQLDKEKNITKELRLRLAAQDAIANQAENLSMKR-- 80
            :|.||:.:.:   ::::.|.:.::                      .|||:..:.||.:|...  
pombe    93 RRTRNRSQTQRRTLLENGFRNSRK----------------------KAQDSSNSIAERVSPPPGF 135

  Fly    81 -KKIAEENKCYICKWNYEVTGDHRP--VSIKCGHLFGANCILHYLQRNKTCPI--CKSQMIR 137
             ..:...|.....|...|:..|.:.  .:.||||||.:.|.....::...||:  |:.::.:
pombe   136 CYDVHPHNNIACAKCGNELVSDEKKSIFAAKCGHLFCSTCAKELRKKTVPCPVQHCRKRITK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 13/48 (27%)
rfp2NP_593439.1 zf-RING_5 147..193 CDD:291308 13/45 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001208
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.