DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG33552 and Rfwd3

DIOPT Version :9

Sequence 1:	NP_001014488.1	Gene:	CG33552 / 3346220	FlyBaseID:	FBgn0053552	Length:	157	Species:	Drosophila melanogaster
Sequence 2:	NP_666330.2	Gene:	Rfwd3 / 234736	MGIID:	2384584	Length:	774	Species:	Mus musculus

Alignment Length:	126	Identity:	32/126 - (25%)
Similarity:	60/126 - (47%)	Gaps:	16/126 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly    27 EKDEIIKDSFESKKRLIDLRLQLDKEKNI--TKELRLRLAAQDAI---ANQAENLSMKRKKIAEE 86
            |.:|::..:.|.:..:        .|:.:  |.:....:...||:   :.|..|: :...:..|.
Mouse   230 EDEEVVVQAEEPEANI--------PEQGVIATDQEATSVTGDDAVPKESPQKPNM-LSAMEDEEG 285

  Fly    87 NKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQ-RNKTCPICKSQMIRCMDVRIIIA 146
            ..|.||...:...||||..:::||||||..||..:|: :.:.||.| ::..:..|:.:|.|
Mouse   286 ETCTICLEQWTNAGDHRISALRCGHLFGFRCISKWLKGQTRKCPQC-NKKAKHSDIVVIYA 345

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG33552	NP_001014488.1	zf-RING_2	87..132	CDD:290367	18/45 (40%)
Rfwd3	NP_666330.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	32..126
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	203..281		9/59 (15%)
		RING	287..334	CDD:238093	19/47 (40%)
		WD40	451..>571	CDD:295369
		WD40	<486..>626	CDD:225201
		WD 1	493..535
		WD40 repeat	501..537	CDD:293791
		WD 2	536..568
		WD40 repeat	542..582	CDD:293791
		WD 3	583..628
		WD40 repeat	590..644	CDD:293791
		WD40 repeat	701..741	CDD:293791
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167836269
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.840