| Sequence 1: | NP_001014488.1 | Gene: | CG33552 / 3346220 | FlyBaseID: | FBgn0053552 | Length: | 157 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_620251.1 | Gene: | Pja2 / 192256 | RGDID: | 620273 | Length: | 707 | Species: | Rattus norvegicus |
| Alignment Length: | 70 | Identity: | 21/70 - (30%) |
|---|---|---|---|
| Similarity: | 35/70 - (50%) | Gaps: | 3/70 - (4%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 64 AAQDAIANQAENLSMK-RKKIAEENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNKT 127
Fly 128 CPICK 132 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG33552 | NP_001014488.1 | RING_Ubox | 85..144 | CDD:473075 | 16/48 (33%) |
| Pja2 | NP_620251.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..23 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 75..120 | ||||
| PRK11151 | 210..>241 | CDD:182999 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 242..290 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 380..403 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 424..493 | ||||
| PEX10 | <467..682 | CDD:227861 | 21/70 (30%) | ||
| Interaction with PRKAR1A, PRKAR2A and PRKAR2B. /evidence=ECO:0000250 | 530..707 | 21/70 (30%) | |||
| Mediates interaction with TBC1D31. /evidence=ECO:0000250|UniProtKB:O43164 | 549..569 | ||||
| RING-H2_PJA1_2 | 632..677 | CDD:438128 | 15/45 (33%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 686..707 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||