DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and Pja2

DIOPT Version :10

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_620251.1 Gene:Pja2 / 192256 RGDID:620273 Length:707 Species:Rattus norvegicus


Alignment Length:70 Identity:21/70 - (30%)
Similarity:35/70 - (50%) Gaps:3/70 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AAQDAIANQAENLSMK-RKKIAEENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQRNKT 127
            |::::|....|.|.:: ...|.:|..|.||...|  ..|.....:.|.|.|...|:..:||::.|
  Rat   607 ASKESIDGLPETLVLEDHTAIGQEQCCPICCSEY--IKDDIATELPCHHFFHKPCVSIWLQKSGT 669

  Fly   128 CPICK 132
            ||:|:
  Rat   670 CPVCR 674

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 RING_Ubox 85..144 CDD:473075 16/48 (33%)
Pja2NP_620251.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..120
PRK11151 210..>241 CDD:182999
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..290
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..403
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..493
PEX10 <467..682 CDD:227861 21/70 (30%)
Interaction with PRKAR1A, PRKAR2A and PRKAR2B. /evidence=ECO:0000250 530..707 21/70 (30%)
Mediates interaction with TBC1D31. /evidence=ECO:0000250|UniProtKB:O43164 549..569
RING-H2_PJA1_2 632..677 CDD:438128 15/45 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 686..707
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.