DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and T01G5.7

DIOPT Version :9

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:NP_506726.2 Gene:T01G5.7 / 187960 WormBaseID:WBGene00011342 Length:260 Species:Caenorhabditis elegans


Alignment Length:146 Identity:37/146 - (25%)
Similarity:59/146 - (40%) Gaps:25/146 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDKQDITKMTKKKLIVEVIKQRKRNKEK--------DEIIKDSFESKKRLIDLRLQL-------D 50
            :.|.:|.:......|::..||.:..:|:        :|:..|:...:..|.....:|       |
 Worm    96 LSKMEIERSNSAIEIMKKDKQLRTTEEQLIMMANLGEELGNDAKRYRSELESAHEELYQTYTIFD 160

  Fly    51 KEKNITKELRLRLAAQDAIANQAENLSMKRKKIAEENKCYICKWNYEVTGDHRPVSIKCGHLFGA 115
            |||:...||         |..|.:.|:....|.....:|.||.|||: ..|..|..:.|||....
 Worm   161 KEKSDLCEL---------IEEQTKKLTESNAKQESRKECPICCWNYD-NEDRLPRVMDCGHTMCH 215

  Fly   116 NCILHYLQRNKTCPIC 131
            .||:..:..:.|.|||
 Worm   216 TCIISTINESDTEPIC 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 17/45 (38%)
T01G5.7NP_506726.2 Smc <20..>189 CDD:224117 20/101 (20%)
RING_Ubox 189..236 CDD:388418 17/44 (39%)
modified RING-HC finger (C3HC3D-type) 190..234 CDD:319361 17/43 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.