DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33552 and rfwd3

DIOPT Version :9

Sequence 1:NP_001014488.1 Gene:CG33552 / 3346220 FlyBaseID:FBgn0053552 Length:157 Species:Drosophila melanogaster
Sequence 2:XP_002667008.1 Gene:rfwd3 / 100329327 ZFINID:ZDB-GENE-120529-1 Length:632 Species:Danio rerio


Alignment Length:59 Identity:24/59 - (40%)
Similarity:32/59 - (54%) Gaps:8/59 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EENKCYICKWNYEVTGDHRPVSIKCGHLFGANCILHYLQ--RNKTCPIC-----KSQMI 136
            |...|.||...:...|:||..:::||||||..||..:|.  .|| ||.|     |:|:|
Zfish   147 EGESCSICFEPWTTAGEHRLAALRCGHLFGYVCISRWLTGGGNK-CPQCNKPAKKTQII 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33552NP_001014488.1 zf-RING_2 87..132 CDD:290367 20/51 (39%)
rfwd3XP_002667008.1 RING 151..197 CDD:238093 20/46 (43%)
DUF972 227..>266 CDD:283750
WD40 <335..>484 CDD:225201
WD40 337..>458 CDD:295369
WD40 repeat 356..393 CDD:293791
WD40 repeat 399..440 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579735
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D273025at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.