DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ddr and htl

DIOPT Version :9

Sequence 1:NP_001014474.3 Gene:Ddr / 3346209 FlyBaseID:FBgn0053531 Length:1054 Species:Drosophila melanogaster
Sequence 2:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster


Alignment Length:396 Identity:109/396 - (27%)
Similarity:171/396 - (43%) Gaps:94/396 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   701 GSQSSGSLSSSTTAATTPTSGVVGVGKP--------------HHYNLDMSANFADINEERANCQV 751
            |..||||:.       |....||.:.|.              :.|...:.:|:            
  Fly   364 GGDSSGSMD-------TMIMPVVRIQKQRTTVLQNGNEPAPFNEYEFPLDSNW------------ 409

  Fly   752 QEFPRQSLVIVEKLGSGVFGELHLCETNVLNATLVAVATLRPGANDHLRKEFRSKAKQLAQLS-- 814
             |.||..||:...||.|.||.:.:.|.|  || :|||..::.|   |...:..|..:::..:.  
  Fly   410 -ELPRSHLVLGATLGEGAFGRVVMAEVN--NA-IVAVKMVKEG---HTDDDIASLVREMEVMKII 467

  Fly   815 --DPNVARLVGACLRDEPICIVQDYS-HCLGDLNQFL---------------QEHVAETSGLMAK 861
              ..|:..|:|.|.::.|:.::.:|: |  |:|..||               |...:..:.::.:
  Fly   468 GRHINIINLLGCCSQNGPLYVIVEYAPH--GNLKDFLYKNRPFGRDQDRDSSQPPPSPPAHVITE 530

  Fly   862 KSLSFGCLVYIATQIASGMKHLEQMNFVHRDLATRSCIIGPELCVKVCSIGTVINRSAYASDYCQ 926
            |.     |:..|.|||.||.:|.....:|||||.|:.::..:..:|:...|  :.|...::||.:
  Fly   531 KD-----LIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFG--LARDIQSTDYYR 588

  Fly   927 LEGFTGRQSQPMPIRWMAWESVLLGKFTTKSDVWSFAVALWEILTFAREQPYEHLSDKSVIENIG 991
             :...||    :||:|||.||:....:.:||||||:.:.||||:|:. :|||      ..|.:..
  Fly   589 -KNTNGR----LPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYG-QQPY------PTIMSAE 641

  Fly   992 LIYRDYKMHELLPMPPNCPREIYDLMCECWQRDESSRPSFREIHLY----LQRK---------NL 1043
            .:|......:.:..|..|...||.||.:||..:...||.|.||..|    ||.|         ||
  Fly   642 ELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVEYMDKLLQTKEDYLDVDIANL 706

  Fly  1044 GFKPQT 1049
            ...|.|
  Fly   707 DTPPST 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdrNP_001014474.3 FA58C 106..262 CDD:214572
FA58C 109..261 CDD:238014
PTKc_DDR 753..1040 CDD:270644 92/310 (30%)
TyrKc 759..1038 CDD:197581 88/302 (29%)
htlNP_524394.2 Ig 112..191 CDD:299845
IG_like 113..191 CDD:214653
IG_like 205..289 CDD:214653
PKc_like 404..692 CDD:304357 92/327 (28%)
STYKc 416..688 CDD:214568 87/298 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455221
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.