| Sequence 1: | NP_001014474.3 | Gene: | Ddr / 3346209 | FlyBaseID: | FBgn0053531 | Length: | 1054 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_650408.1 | Gene: | Sdr / 41809 | FlyBaseID: | FBgn0038279 | Length: | 868 | Species: | Drosophila melanogaster |
| Alignment Length: | 40 | Identity: | 14/40 - (35%) |
|---|---|---|---|
| Similarity: | 18/40 - (45%) | Gaps: | 1/40 - (2%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 112 MESGAIADFQITASSAHDMGNVGPQHARLKIDNNGGAWCP 151 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ddr | NP_001014474.3 | FA58C | 109..261 | CDD:238014 | 14/40 (35%) |
| PTKc_DDR | 753..1040 | CDD:270644 | |||
| Sdr | NP_650408.1 | Recep_L_domain | 58..173 | CDD:460032 | 4/17 (24%) |
| Furin-like | 210..332 | CDD:395614 | |||
| Recep_L_domain | 347..461 | CDD:460032 | |||
| FN3 | 491..578 | CDD:214495 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||