DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ddr and Tie

DIOPT Version :9

Sequence 1:NP_001014474.3 Gene:Ddr / 3346209 FlyBaseID:FBgn0053531 Length:1054 Species:Drosophila melanogaster
Sequence 2:NP_523928.1 Gene:Tie / 38559 FlyBaseID:FBgn0014073 Length:1233 Species:Drosophila melanogaster


Alignment Length:392 Identity:110/392 - (28%)
Similarity:162/392 - (41%) Gaps:95/392 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   729 HHYNLDMS-ANFADINEERAN---------CQVQEFPRQSLVIVEKLGSGVFGELHLCETNVLN- 782
            ||..:.|| |:..|.|..|..         .:..:|.|.::.:...||.|.||::...|.:.|: 
  Fly   814 HHQAMPMSQASQRDANHNRYGNNDDKTSLASEFHDFERSNIRLKSLLGEGNFGQVWKAEADDLSG 878

  Fly   783 ---AT-LVAVATLRP-GANDHLRKEFRSKAKQLAQL-SDPNVARLVGACLRDEPICIVQDYSHCL 841
               || :|||.|:|. .|...|:.|    |..:.:| |..||..|:|||:..||..::.:|: ..
  Fly   879 HFGATRIVAVKTIRACSAQVSLKDE----ANIMRKLGSHQNVVTLLGACVESEPHMLIMEYA-MR 938

  Fly   842 GDLNQFLQEHVAETSGLMAK-------KSLSFGCLVYIATQIASGMKHLEQMNFVHRDLATRSCI 899
            |.|...|:...:.|:.|.|.       ..||...|...|..||.||:::.....||||||.|:.:
  Fly   939 GRLLSLLRAARSATNILPASVPGGRSLAPLSPRTLAGFALDIACGMEYIAGRRIVHRDLAARNVL 1003

  Fly   900 IGPELCVKVCSIGTVINRSA--------------------------YASDYC-----------QL 927
            :......|:|..|..|:..|                          :.|.|.           |.
  Fly  1004 LDHNGMCKICDFGMSIDLDAERMRKEQEKNAANDLMRHNAHKFKFDFGSRYILQHWQHTFGQGQG 1068

  Fly   928 EGFTGRQSQP------------------MPIRWMAWESVLLGKFTTKSDVWSFAVALWEILTFAR 974
            :|...: .||                  :||||||.||:....|||::|:|:|.:.||||.|.. 
  Fly  1069 QGHCSK-DQPHGEKKSHHGHDTIGKRHALPIRWMAPESLQYHMFTTETDIWAFGIVLWEIATLG- 1131

  Fly   975 EQPYEHLSDKSVIENIGLIYRDYKMHELLP-MPPNCPREIYDLMCECWQRDESSRPSFREIHLYL 1038
            ..||..|:.:.||..:        ...|.| :|.....|.|:||..||.::...||||.:..|.:
  Fly  1132 STPYSQLTGREVIRRV--------PQGLRPDLPKESRHEFYNLMSRCWHKEPHMRPSFAQSRLEI 1188

  Fly  1039 QR 1040
            .|
  Fly  1189 TR 1190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdrNP_001014474.3 FA58C 106..262 CDD:214572
FA58C 109..261 CDD:238014
PTKc_DDR 753..1040 CDD:270644 101/356 (28%)
TyrKc 759..1038 CDD:197581 99/348 (28%)
TieNP_523928.1 TyrKc 854..1183 CDD:197581 98/343 (29%)
PTKc 860..1187 CDD:270623 98/341 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455257
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.