DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ddr and Ror

DIOPT Version :9

Sequence 1:NP_001014474.3 Gene:Ddr / 3346209 FlyBaseID:FBgn0053531 Length:1054 Species:Drosophila melanogaster
Sequence 2:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster


Alignment Length:355 Identity:116/355 - (32%)
Similarity:186/355 - (52%) Gaps:37/355 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   684 YYAATPVSSKPMPVAPPGSQSSGSLSSSTTAATTPTSGVVGVGKPHHYNL-DMSANFADINEERA 747
            :|....:.:...|.|......:..|:::..|           |:.:..|| |..|..:.:.|...
  Fly   345 HYGMRNIHNINTPSADKNIYGNSQLNNAQDA-----------GRGNLGNLSDHVALNSKLIERNT 398

  Fly   748 NCQVQEFPRQSLVIVEKLGSGVFGELH---LCETNVLNATLVAVATLRPGANDHLRKEFRSKAKQ 809
            ..::..|..|.:..:|:||.|.||:::   |.:.|....| ||:..|:..|:...:::|:.:.:.
  Fly   399 LLRINHFTLQDVEFLEELGEGAFGKVYKGQLLQPNKTTIT-VAIKALKENASVKTQQDFKREIEL 462

  Fly   810 LAQLSDPNVARLVGACLRDEPICIVQDYSHCLGDLNQFLQEHVAETSGLMAKKSLSFGCLVYIAT 874
            ::.|...|:..::|..|..||.|::.:|. ..|||::||..: :.|.|    ||||....:.||.
  Fly   463 ISDLKHQNIVCILGVVLNKEPYCMLFEYM-ANGDLHEFLISN-SPTEG----KSLSQLEFLQIAL 521

  Fly   875 QIASGMKHLEQMNFVHRDLATRSCIIGPELCVKVCSIGTVINRSAYASDYCQLEGFTGRQSQPMP 939
            ||:.||::|...::||||||.|:|::...|.||:...|  ::|..|:|||.:::     ....:|
  Fly   522 QISEGMQYLSAHHYVHRDLAARNCLVNEGLVVKISDFG--LSRDIYSSDYYRVQ-----SKSLLP 579

  Fly   940 IRWMAWESVLLGKFTTKSDVWSFAVALWEILTFAREQPYEHLSDKSVIENIGLIYRDYKMHELLP 1004
            :|||..||:|.|||||:||||||.|.||||.::.. |||...|::.||..|       :..:||.
  Fly   580 VRWMPSESILYGKFTTESDVWSFGVVLWEIYSYGM-QPYYGFSNQEVINLI-------RSRQLLS 636

  Fly  1005 MPPNCPREIYDLMCECWQRDESSRPSFREI 1034
            .|.|||..:|.||.|||......||:|.:|
  Fly   637 APENCPTAVYSLMIECWHEQSVKRPTFTDI 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdrNP_001014474.3 FA58C 106..262 CDD:214572
FA58C 109..261 CDD:238014
PTKc_DDR 753..1040 CDD:270644 105/285 (37%)
TyrKc 759..1038 CDD:197581 103/279 (37%)
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568
KR 235..312 CDD:214527
PTKc_Ror 404..673 CDD:270642 105/285 (37%)
Pkinase_Tyr 410..670 CDD:285015 103/279 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455264
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.