DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ddr and CG3277

DIOPT Version :9

Sequence 1:NP_001014474.3 Gene:Ddr / 3346209 FlyBaseID:FBgn0053531 Length:1054 Species:Drosophila melanogaster
Sequence 2:NP_608762.3 Gene:CG3277 / 33543 FlyBaseID:FBgn0031518 Length:789 Species:Drosophila melanogaster


Alignment Length:473 Identity:100/473 - (21%)
Similarity:172/473 - (36%) Gaps:152/473 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   690 VSSKPMPVAPPGSQSSGSLSSS---------------------------TTA----------ATT 717
            |:..|:|..|.......|:|:|                           |||          .|.
  Fly   325 VTKVPVPANPVLLTEGDSVSNSIIVMSAMLIAIILAGLIMLLLRRRRARTTAKLRKQEQIYIQTF 389

  Fly   718 PTSGVVGVGKPHHYNLDMSANFADINEERAN----CQVQEFPRQSLVIVEKLGSGVFGELHLCET 778
            .||.:         .::.:.|:.|...|::.    ..:.|.|..::.|...||.|.||::|  |.
  Fly   390 ATSAI---------EMEDNVNYVDKYVEKSQVLGLADIFEVPHSAIQIGRMLGEGAFGQVH--EA 443

  Fly   779 NVLN------ATLVAVATLRPGANDHLRKEFRSKAKQLAQL-SDPNVARLVGACLRDEPICIVQD 836
            ..:|      .|:|||..|:|........|:.::.:.|..: :..||...:|.|....|..::.:
  Fly   444 TAINLRRMRGTTIVAVKQLKPNPKADEVAEYLAEIEMLKGVGTHHNVVSFLGCCTIKPPYLMIME 508

  Fly   837 YSHCLGDLNQFLQEHVAETSGLMAKKSLSFGC--------------------------------- 868
            |.: .|:|..:|:....|.|.|..:.:....|                                 
  Fly   509 YVN-KGNLLSYLRTVRKEASKLRNRNANYTSCRPIMTRTNSTSSPKSQSVNYIELKASSQTIEMP 572

  Fly   869 -------------------------------LVYI---------ATQIASGMKHLEQMNFVHRDL 893
                                           ..||         |.|||:||:.||:....||||
  Fly   573 QEDSTAHMNGIRQPHPSFAETTYTIVEDEDAFEYILDNKELHNFALQIANGMRFLEEQEITHRDL 637

  Fly   894 ATRSCIIGPELCVKVCSIGTVINRSAYASDYCQLEGFTGRQSQPMPIRWMAWESVLLGKFTTKSD 958
            |.|:.:|.....:|:...|  ::|...         :|..:::.:|:||::.|::....:::|||
  Fly   638 AARNVLIDSNKTLKISDFG--LSRHGI---------YTNTRTRKLPLRWLSIEAIRENVYSSKSD 691

  Fly   959 VWSFAVALWEILTFAREQPYEHLSDKSVIENIGLIYRDYKMHELLPMPPNCPREIYDLMCECWQR 1023
            :|::.|.||||.|.. ..||..:|:..:|..:....|       |..|..|..::|.:|.:||..
  Fly   692 IWAYGVVLWEIGTLG-ASPYPTISNDELIPFLMAGNR-------LERPEICTPQVYTIMLQCWLE 748

  Fly  1024 DESSRPSFREIHLYLQRK 1041
            :...||:|..::..|..|
  Fly   749 EPEERPTFDALYKVLSPK 766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DdrNP_001014474.3 FA58C 106..262 CDD:214572
FA58C 109..261 CDD:238014
PTKc_DDR 753..1040 CDD:270644 83/366 (23%)
TyrKc 759..1038 CDD:197581 80/358 (22%)
CG3277NP_608762.3 STYKc 426..763 CDD:214568 80/358 (22%)
PTKc 430..763 CDD:270623 79/354 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455256
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24416
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.