DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and CD86

DIOPT Version :10

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_787058.5 Gene:CD86 / 942 HGNCID:1705 Length:329 Species:Homo sapiens


Alignment Length:101 Identity:28/101 - (27%)
Similarity:40/101 - (39%) Gaps:26/101 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 SLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESK-------DSREWTLHVKAPLAKDSGIYE 320
            ||.:..|.|..:.:|    |....|...::|....||       ||..|||.:.....||.|:|:
Human    49 SLSELVVFWQDQENL----VLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQ 109

  Fly   321 C--------------QVNTEPKMSMAF-QLNIIEIS 341
            |              |:|:|..:...| |..|:.||
Human   110 CIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPIS 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 IG_like 243..329 CDD:214653 23/86 (27%)
Ig strand B 255..259 CDD:409353
Ig strand C 269..272 CDD:409353 1/2 (50%)
Ig strand E 304..308 CDD:409353 3/3 (100%)
Ig strand F 318..323 CDD:409353 2/18 (11%)
IG_like <441..477 CDD:214653
CD86NP_787058.5 IgV_CD86 26..133 CDD:409508 23/87 (26%)
FR1 26..40 CDD:409508
Ig strand A 26..31 CDD:409508
Ig strand B 34..40 CDD:409508
CDR1 41..52 CDD:409508 2/2 (100%)
FR2 53..60 CDD:409508 2/6 (33%)
Ig strand C 53..59 CDD:409508 2/5 (40%)
CDR2 62..82 CDD:409508 5/23 (22%)
Ig strand C' 64..69 CDD:409508 1/4 (25%)
Ig strand C' 72..74 CDD:409508 0/1 (0%)
FR3 83..115 CDD:409508 10/31 (32%)
Ig strand D 85..89 CDD:409508 0/3 (0%)
Ig strand E 93..99 CDD:409508 3/5 (60%)
Ig strand F 106..114 CDD:409508 3/7 (43%)
CDR3 116..118 CDD:409508 0/1 (0%)
FR4 119..133 CDD:409508 3/13 (23%)
Ig strand G 120..133 CDD:409508 3/12 (25%)
Ig 136..221 CDD:472250 5/10 (50%)
Ig strand B 152..157 CDD:409505
Ig strand C 167..172 CDD:409505
Ig strand E 201..205 CDD:409505
Ig strand F 215..220 CDD:409505
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.