DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and PAPLN

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001352835.1 Gene:PAPLN / 89932 HGNCID:19262 Length:1278 Species:Homo sapiens


Alignment Length:461 Identity:99/461 - (21%)
Similarity:139/461 - (30%) Gaps:145/461 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 WPF-------CNGLAAAAASTGQPDDS--------GDGPTL-------STFLSSSQSQSPSPPAA 166
            ||:       ..||...|.|...|..|        |..|:|       ...||.|...:|...||
Human   878 WPWGQELGSRAPGLGGDAGSPAPPFHSSSYRISLAGVEPSLVQAALGQLVRLSCSDDTAPESQAA 942

  Fly   167 SASASSPSS-------FSSFAVAHGPQTE--------ATNHTFKSLAFLDASFGSDLFAQTDAKR 216
            ......|.|       |....:.|..|.|        :|.....|........|.|:...::|:.
Human   943 WQKDGQPISSDRHRLQFDGSLIIHPLQAEDAGTYSCGSTRPGRDSQKIQLRIIGGDMAVLSEAEL 1007

  Fly   217 ERSGAADEESQD------------ADTSQSLPI----FDFGMPRNITGRTGHTEAIIKCRVDSLH 265
            .|.....:.:||            ..:|...|.    .|...||.:....|. ...:.||.:...
Human  1008 SRFPQPRDPAQDFGQAGAAGPLGAIPSSHPQPANRLRLDQNQPRVVDASPGQ-RIRMTCRAEGFP 1071

  Fly   266 DKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKAPLAKDSGIYEC-QVNTEPKM 329
            ..::.|  :||        ....|..|.|:     ..:.:|.:.....:|.|.|.| ..|.:.:.
Human  1072 PPAIEW--QRD--------GQPVSSPRHQL-----QPDGSLVISRVAVEDGGFYTCVAFNGQDRD 1121

  Fly   330 SMAFQLNIIEISPDAKAVISG-PPDLHFKAGSAIILNCLVQQPSVKDIGPIYWYRGEHMITPFDA 393
            ....||.::     .:..||| ||.:....|....|.|:|...||.    |.|.|..   .|..|
Human  1122 QRWVQLRVL-----GELTISGLPPTVTVPEGDTARLLCVVAGESVN----IRWSRNG---LPVQA 1174

  Fly   394 DDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDT 458
            |          |......|:.|                                |.|.|.:..|.
Human  1175 D----------GHRVHQSPDGT--------------------------------LLIYNLRARDE 1197

  Fly   459 GNYTC---QPTTASSASVLVHVINDENPAAMQKSGACPCALGPLQLLLHLLLLPEL----LLLRA 516
            |:|||   |.:.|.|.|..|.|::.. |.|..:.....|           :..|||    |:|:|
Human  1198 GSYTCSAYQGSQAVSRSTEVKVVSPA-PTAQPRDPGRDC-----------VDQPELANCDLILQA 1250

  Fly   517 GLAAGN 522
            .| .||
Human  1251 QL-CGN 1255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 17/87 (20%)
IG_like 243..329 CDD:214653 17/86 (20%)
Ig 350..464 CDD:299845 26/117 (22%)
IG_like <441..477 CDD:214653 13/38 (34%)
PAPLNNP_001352835.1 TSP1 29..80 CDD:214559
ADAM_spacer1 183..298 CDD:310520
TSP1 308..361 CDD:214559
TSP1 369..424 CDD:214559
TSP1 424..481 CDD:214559
TSP1 488..539 CDD:214559
Kunitz_BPTI 753..805 CDD:278443
Papilin_u7 814..905 CDD:318767 7/26 (27%)
Ig 914..>978 CDD:325142 14/63 (22%)
I-set 1049..1119 CDD:254352 17/85 (20%)
IG 1139..1219 CDD:214652 30/128 (23%)
PLAC 1235..1267 CDD:312271 10/33 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.