DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and dpr21

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:285 Identity:94/285 - (32%)
Similarity:141/285 - (49%) Gaps:70/285 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 PIFDFGMPRNIT---GRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTE 297
            |.||....:|:|   |.|||    :.||:.:|.:|:|||||.||||:|||..:|||||:||....
  Fly    51 PYFDTSATKNVTSLVGITGH----LNCRIKNLGNKTVSWIRHRDLHLLTVSESTYTSDQRFTSIY 111

  Fly   298 SKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDLHFKAGSAI 362
            :|.:.:|:|.:|.|..:|||||||||:|.|.:......:::|  |...  |.|.|:::...||.:
  Fly   112 NKQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMVFSVVE--PITS--ILGGPEIYIDLGSTV 172

  Fly   363 ILNCLVQ---QPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEV 424
            .|.|:::   .|.:.    :.|......|. :|:              |:|              
  Fly   173 NLTCVIKHLPDPPIS----VQWNHNNQEIN-YDS--------------PRG-------------- 204

  Fly   425 DLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQPTTASSASVLVHVINDENPAAMQKS 489
                    .:::.::.||...|.|.|..|...|:|.|||.|:.|:|.||.||::..::|||:|||
  Fly   205 --------GVSVITEKGDITTSYLLIQRASIADSGQYTCLPSNANSKSVNVHILKGDHPAAVQKS 261

  Fly   490 GACPCALGPLQLLLHLLLLPELLLL 514
                          | ||:.|||.|
  Fly   262 --------------H-LLVSELLSL 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 45/89 (51%)
IG_like 243..329 CDD:214653 45/88 (51%)
Ig 350..464 CDD:299845 22/116 (19%)
IG_like <441..477 CDD:214653 17/35 (49%)
dpr21NP_001163838.2 Ig 71..149 CDD:299845 39/77 (51%)
IG_like 71..140 CDD:214653 37/68 (54%)
IG_like 162..249 CDD:214653 28/127 (22%)
IGc2 169..242 CDD:197706 23/113 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444734
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I5388
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.