DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and KIRREL3

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:XP_011541328.1 Gene:KIRREL3 / 84623 HGNCID:23204 Length:809 Species:Homo sapiens


Alignment Length:282 Identity:58/282 - (20%)
Similarity:104/282 - (36%) Gaps:70/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 LDASFGSDL-----------FAQTDAKRERSGA-------ADEESQDADTSQSLPIFDFG-MPRN 245
            :|||.|:.|           ..|.:...::.|.       |.::.:..:..|   ::.|. .|::
Human     1 MDASLGAGLRCSGIASSPLRMQQNELGLQKRGCCLVLGYMAKDKFRRMNEGQ---VYSFSQQPQD 62

  Fly   246 ITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSREWTLHVKA 310
            ....:|....:: |.:.. :|..|.||  :|...|.|| ...:|..::.|..:..|.|..|.:..
Human    63 QVVVSGQPVTLL-CAIPE-YDGFVLWI--KDGLALGVG-RDLSSYPQYLVVGNHLSGEHHLKILR 122

  Fly   311 PLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDLHFKAGSAIILNCLVQQPSVKD 375
            ...:|..:||||.......|...:|.:: :.||...::.||. :..:||..:.|.|  ...:.|.
Human   123 AELQDDAVYECQAIQAAIRSRPARLTVL-VPPDDPVILGGPV-ISLRAGDPLNLTC--HADNAKP 183

  Fly   376 IGPIYWYR-GEHM-----------------------ITPFDADDGQ--------PEIPAGRG--- 405
            ...|.|.| ||.:                       |:|.|.::||        ..||.|:.   
Human   184 AASIIWLRKGEVINGATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGKETSV 248

  Fly   406 ----EHPQGIPEDTSPNDIMSE 423
                :||..:.....|..::.:
Human   249 TIDIQHPPLVNLSVEPQPVLED 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 21/86 (24%)
IG_like 243..329 CDD:214653 21/85 (25%)
Ig 350..464 CDD:299845 23/113 (20%)
IG_like <441..477 CDD:214653
KIRREL3XP_011541328.1 Ig 58..149 CDD:299845 23/95 (24%)
IG_like 60..149 CDD:214653 23/93 (25%)
I-set 156..249 CDD:254352 20/95 (21%)
Ig2_KIRREL3-like 171..252 CDD:143236 16/82 (20%)
Ig_2 260..337 CDD:290606 1/11 (9%)
I-set 341..422 CDD:254352
IGc2 355..406 CDD:197706
Ig5_KIRREL3 424..521 CDD:143306
IG_like 432..521 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.