Sequence 1: | NP_001014459.2 | Gene: | dpr3 / 3346208 | FlyBaseID: | FBgn0053516 | Length: | 522 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001018172.1 | Gene: | nitr2a / 795524 | ZFINID: | ZDB-GENE-020225-28 | Length: | 328 | Species: | Danio rerio |
Alignment Length: | 202 | Identity: | 44/202 - (21%) |
---|---|---|---|
Similarity: | 63/202 - (31%) | Gaps: | 55/202 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 226 SQDADTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSD 290
Fly 291 KRFQVTESKDSREWTLHVKAPLAKDSGIYECQV-NTEPKMSMAFQLNIIEISPDAKAVISGPPDL 354
Fly 355 HFKAGSAII---------------LNCLVQQPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGR 404
Fly 405 GEHPQGI 411 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr3 | NP_001014459.2 | Ig | 243..330 | CDD:299845 | 19/87 (22%) |
IG_like | 243..329 | CDD:214653 | 19/86 (22%) | ||
Ig | 350..464 | CDD:299845 | 17/77 (22%) | ||
IG_like | <441..477 | CDD:214653 | |||
nitr2a | NP_001018172.1 | IgV | 27..126 | CDD:143167 | 25/119 (21%) |
IG_like | 28..126 | CDD:214653 | 24/118 (20%) | ||
Ig | 141..234 | CDD:299845 | 11/56 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1457433at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |