DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and nitr2a

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001018172.1 Gene:nitr2a / 795524 ZFINID:ZDB-GENE-020225-28 Length:328 Species:Danio rerio


Alignment Length:202 Identity:44/202 - (21%)
Similarity:63/202 - (31%) Gaps:55/202 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 SQDADTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSD 290
            |:..||...|.|...|...|.|           |.:.:....||.||::      :||....|..
Zfish    16 SETTDTQNYLKIVQAGDTVNFT-----------CSLLNEIRNSVVWIKQ------SVGKNPLTVV 63

  Fly   291 KRFQVTESKDSREWTLHVKAPLAKDSGIYECQV-NTEPKMSMAFQLNIIEISPDAKAVISGPPDL 354
            ..||..:.|...::..|.:..:.||...:...: |||...|..:..    |:...........||
Zfish    64 SSFQNVDHKFENDFDKHNRFFVTKDDVSFNLSITNTEVSDSATYYC----ITYAYHFTFGNSTDL 124

  Fly   355 HFKAGSAII---------------LNCLVQQPSVKDIGPIYWYRGEHMITPFDADDGQPEIPAGR 404
            ..|||...|               |.|.|...|..:...:||:|..                  .
Zfish   125 IVKAGGVNIKSEHQKPASESPSEDLQCSVISQSCAEEHKVYWFRQR------------------S 171

  Fly   405 GEHPQGI 411
            ||.|.|:
Zfish   172 GESPPGV 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 19/87 (22%)
IG_like 243..329 CDD:214653 19/86 (22%)
Ig 350..464 CDD:299845 17/77 (22%)
IG_like <441..477 CDD:214653
nitr2aNP_001018172.1 IgV 27..126 CDD:143167 25/119 (21%)
IG_like 28..126 CDD:214653 24/118 (20%)
Ig 141..234 CDD:299845 11/56 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.