DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and Sirpd

DIOPT Version :10

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001070147.1 Gene:Sirpd / 751864 MGIID:3780136 Length:178 Species:Mus musculus


Alignment Length:232 Identity:45/232 - (19%)
Similarity:64/232 - (27%) Gaps:99/232 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   300 DSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDLHFKAGSAIIL 364
            |.|..|||                   ..:.|...|.:...:.....||.....:....|.:.||
Mouse     5 DFRPHTLH-------------------RTLLMTLLLGLTGTAAKELKVIQPEKSVSVITGESTIL 50

  Fly   365 NCLVQQPSVKDIGPIYWYR--GE--HMITPFDADDGQPEIPAGRGEHPQGIPEDTSPNDIMSEVD 425
            ||.|  .|:..:|||.|.|  |:  .:|..|            .|||   .|...:.:|.....:
Mouse    51 NCTV--TSLLPVGPIKWIRKMGQCRQLIYSF------------TGEH---FPRVRNVSDATKRSN 98

  Fly   426 LQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGN------------------------YTCQPT 466
            |...                  :.|||....|.|.                        |.|:..
Mouse    99 LDFS------------------IHISNVTLADYGTYYCVKFLRTYSEEEEFQYGGGTQLYVCEQK 145

  Fly   467 TASSASVLVHVINDENPAAMQKSGACPCALGPLQLLL 503
            |..:|.::|..:                 |||..||:
Mouse   146 TTDTAKIIVASL-----------------LGPKLLLV 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 IG_like 243..329 CDD:214653 5/28 (18%)
Ig strand B 255..259 CDD:409353
Ig strand C 269..272 CDD:409353
Ig strand E 304..308 CDD:409353 2/3 (67%)
Ig strand F 318..323 CDD:409353 0/4 (0%)
IG_like <441..477 CDD:214653 10/59 (17%)
SirpdNP_001070147.1 Ig 32..141 CDD:472250 28/143 (20%)
Ig strand B 48..52 CDD:409353 2/3 (67%)
Ig strand C 62..66 CDD:409353 2/3 (67%)
Ig strand E 101..105 CDD:409353 0/21 (0%)
Ig strand F 115..120 CDD:409353 0/4 (0%)
Ig strand G 134..137 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.