DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and nitr4a

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_571729.1 Gene:nitr4a / 60652 ZFINID:ZDB-GENE-001106-11 Length:337 Species:Danio rerio


Alignment Length:287 Identity:68/287 - (23%)
Similarity:106/287 - (36%) Gaps:59/287 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 ITGRTGHTEAIIKCRV--DSLHDKSVSWIRK--RDLHILTVGT------ATYTSD----KRFQVT 296
            :|.:.||. .::.|.:  |:.|  .|.|.::  .:..::.|.:      ..::||    :||...
Zfish    31 LTTQEGHI-VLLPCLLLEDNFH--RVIWYKQVLGEKPVVIVSSYHHSQPNEFSSDFKETQRFHAV 92

  Fly   297 ESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAK-AVISGPPDLHFKAGS 360
            ...||  :.|.::..|..|||.|.|.......:|......::....|.| |||..|.....|.||
Zfish    93 RKADS--FNLTIRRTLKSDSGTYFCGSAFTHVVSFGTGTILLVK
GADLKPAVIQLPVHAVIKPGS 155

  Fly   361 AIILNCLVQQPSV-KDIGPIYWYRGEHMITPFDADDGQPEIPAGRGEHPQGI--PEDTSPNDIMS 422
            .:.|.|.|:..:. |.:..:||:|.....|                 | |||  ....|.|:...
Zfish   156 NVTLRCSVEGKTCDKGVQSVYWFRQSSSTT-----------------H-QGIVYTHGKSKNECAD 202

  Fly   423 EVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTCQPTTASSASVLVHVINDE-NPAAM 486
            ..|.|          |.|.:..|..:.:|.|........||......:.:.|  ||.|. ...::
Zfish   203 SSDTQ----------SCLQNLAKMSVNVSEAGLYYCSVVTCDEVLFGNGTTL--VIKDGFISESI 255

  Fly   487 QKSGACPCALGPLQLLLHLLLLPELLL 513
            ||     |.|..|.:|..:.|...:||
Zfish   256 QK-----CILIGLTVLSAVSLTINILL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 22/97 (23%)
IG_like 243..329 CDD:214653 22/96 (23%)
Ig 350..464 CDD:299845 26/116 (22%)
IG_like <441..477 CDD:214653 6/35 (17%)
nitr4aNP_571729.1 Ig 24..134 CDD:299845 23/107 (21%)
IG_like 29..127 CDD:214653 23/100 (23%)
V-set 144..246 CDD:284989 28/131 (21%)
IG_like 146..246 CDD:214653 28/129 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.