DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and nitr2b

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_571724.1 Gene:nitr2b / 60647 ZFINID:ZDB-GENE-001106-6 Length:313 Species:Danio rerio


Alignment Length:209 Identity:39/209 - (18%)
Similarity:61/209 - (29%) Gaps:71/209 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 ESQDADTSQSLPIFDFGMPRNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTS 289
            ::.|......:.|...|:..|:|           |........||.|:::|      ||......
Zfish    18 DNADIKGQNHVMIVQAGVAVNLT-----------CIFPKESRTSVVWVKQR------VGEKPLLI 65

  Fly   290 DKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNI--IEISPDA-------- 344
            ...:|....|...::....:..:.||.|              :|.|:|  .|||..|        
Zfish    66 ASAYQGLAGKYENDFDKQNRFFIEKDEG--------------SFNLSIANTEISDTATYYCVAYV 116

  Fly   345 -KAVISGPPDLHFKAGSAIILN-----------CLVQQPSVKDIGPIYWYRGEHMITPFDADDGQ 397
             :.:.....||...||...|.:           |.|...|..:...:||:|              
Zfish   117 YEFIFGNSTDLIVNAGKLNIKSEHQRSASEDQQCSVISQSCAEEHKVYWFR-------------- 167

  Fly   398 PEIPAGRGEHPQGI 411
                .|.||...|:
Zfish   168 ----QGSGESSPGV 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 14/86 (16%)
IG_like 243..329 CDD:214653 14/85 (16%)
Ig 350..464 CDD:299845 15/73 (21%)
IG_like <441..477 CDD:214653
nitr2bNP_571724.1 IG_like 28..129 CDD:214653 25/131 (19%)
IgV 29..129 CDD:143167 25/130 (19%)
Ig 149..232 CDD:299845 10/47 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.