DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr3 and nitr1c

DIOPT Version :9

Sequence 1:NP_001014459.2 Gene:dpr3 / 3346208 FlyBaseID:FBgn0053516 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_938164.2 Gene:nitr1c / 60645 ZFINID:ZDB-GENE-001106-4 Length:328 Species:Danio rerio


Alignment Length:243 Identity:52/243 - (21%)
Similarity:82/243 - (33%) Gaps:44/243 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 DADTSQSLPIFDFGMPRNIT----GRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYT 288
            |.....::.|.:.|...|.|    |....|:|..|......:.:.||...|:.|.    ..:::.
Zfish    20 DVVQEDTVKIVEAGGDVNFTCIFPGHVPSTKAWFKQTTVGKYLQIVSLDLKKQLK----WNSSFE 80

  Fly   289 SDKRFQVTESKDSREWTLHVKAPLAKDSGIYECQVNTEPKMSM--AFQLNIIEISPDAKAVISGP 351
            ...||.||:..|....|:....|  .||..|.|.|:....:.|  |.:|.:.:.:.|....:...
Zfish    81 KTNRFNVTKVDDYFNLTILKTKP--SDSATYYCVVSAYETIGMGSATRLLVKDAATDRNTTLHQS 143

  Fly   352 PDLHFKAGSAIILNCLVQQPSVKDIGPIYWYRGEHMITPFDADDGQPE-IPAGRGEHPQGIPEDT 415
            .......|.::.|.|.:...|......:||         |....|.|| :...:||.......:|
Zfish   144 LIETVDPGDSVNLQCSIFTESCAGDHSVYW---------FKQSSGHPEGVLYTKGERNGRCKNNT 199

  Fly   416 SPNDIMSEVDLQMEFATRIAMESQLGDTLKSRLRISNAQTTDTGNYTC 463
                                 |||....:.| |..:|...:|:|.|.|
Zfish   200 ---------------------ESQTQSCVYS-LHKNNISRSDSGIYYC 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr3NP_001014459.2 Ig 243..330 CDD:299845 22/90 (24%)
IG_like 243..329 CDD:214653 22/89 (25%)
Ig 350..464 CDD:299845 23/115 (20%)
IG_like <441..477 CDD:214653 7/23 (30%)
nitr1cNP_938164.2 V-set 23..129 CDD:311561 27/111 (24%)
V-set 147..244 CDD:311561 23/110 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1457433at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.