| Sequence 1: | NP_001014459.2 | Gene: | dpr3 / 3346208 | FlyBaseID: | FBgn0053516 | Length: | 522 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001097508.2 | Gene: | DIP-delta / 5740816 | FlyBaseID: | FBgn0085420 | Length: | 469 | Species: | Drosophila melanogaster |
| Alignment Length: | 287 | Identity: | 69/287 - (24%) |
|---|---|---|---|
| Similarity: | 102/287 - (35%) | Gaps: | 77/287 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 240 FGMP-RNITGRTGHTEAIIKCRVDSLHDKSVSWIRKRDLHILTVGTATYTSDKRFQVTESKDSRE 303
Fly 304 WTLHVKAPLAKDSGIYECQVNTEPKMSMAFQLNIIEISPDAKAVISGPPDLHFKAGSAIILNCLV 368
Fly 369 QQ-PSVKDIGPIYWYR--GEHM-------ITPFDADDGQPEIPAGRGE-------HPQGIPEDTS 416
Fly 417 PNDIMSEVDLQMEFATRIAMESQL-----GDTL-------------------------------- 444
Fly 445 --------KSRLRISNAQTTDTGNYTC 463 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr3 | NP_001014459.2 | Ig | 243..330 | CDD:299845 | 29/87 (33%) |
| IG_like | 243..329 | CDD:214653 | 29/86 (34%) | ||
| Ig | 350..464 | CDD:299845 | 35/176 (20%) | ||
| IG_like | <441..477 | CDD:214653 | 10/63 (16%) | ||
| DIP-delta | NP_001097508.2 | IG | 51..143 | CDD:214652 | 30/95 (32%) |
| Ig | 145..238 | CDD:416386 | 22/102 (22%) | ||
| Ig strand A | 145..149 | CDD:409353 | 1/3 (33%) | ||
| Ig strand A' | 154..159 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 165..172 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 178..183 | CDD:409353 | 3/8 (38%) | ||
| Ig strand C' | 185..187 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 195..199 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 203..209 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 216..223 | CDD:409353 | 0/6 (0%) | ||
| Ig strand G | 230..238 | CDD:409353 | 2/12 (17%) | ||
| Ig | 242..333 | CDD:416386 | 13/77 (17%) | ||
| Ig strand A' | 250..253 | CDD:409353 | 1/2 (50%) | ||
| Ig strand B | 259..266 | CDD:409353 | 0/6 (0%) | ||
| Ig strand C | 272..277 | CDD:409353 | 0/4 (0%) | ||
| Ig strand C' | 281..283 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 289..293 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 295..305 | CDD:409353 | 1/9 (11%) | ||
| Ig strand F | 314..322 | CDD:409353 | 4/5 (80%) | ||
| Ig strand G | 325..334 | CDD:409353 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||